Loading...
Statistics
Advertisement

辽化教育基金
www.lhjyjj.com/

Lhjyjj.com

Advertisement
Conversion Technology Metas Server
Lhjyjj.com is hosted in China / Hangzhou . Lhjyjj.com doesn't use HTTPS protocol. Number of used technologies: 3. First technologies: CSS, Html, Javascript, Number of used javascripts: 5. First javascripts: Jquery1.7.2.js, Metinfo_ui.js, Jquery-1.4.2.js, Number of used analytics tools: 0. Its server type is: Microsoft-IIS/7.5.

Technologies in use by Lhjyjj.com

Technology

Number of occurences: 3
  • CSS
  • Html
  • Javascript

Advertisement

Javascripts

Number of occurences: 5
  • jquery1.7.2.js
  • metinfo_ui.js
  • jquery-1.4.2.js
  • banner.js
  • fun.inc.js

Server Type

  • Microsoft-IIS/7.5

Powered by

  • ASP.NET

Conversion rate optimization
visitors Clickable call number Not founded!
visitors Conversion form (contact form, subcriber) Not founded!
visitors Clickable email Not founded!
visitors CTA (call to action) button Not founded!
visitors List Founded!
visitors Image Not founded!
visitors Enhancement Not founded!
visitors Responsive website Not founded!
visitors Facebook sharing Not founded!
visitors Google+ sharing Not founded!
visitors Twitter sharing Not founded!
visitors Linkedin sharing Not founded!
visitors Blog on the webiste Not founded!

HTTPS (SSL) - Lhjyjj.com

Missing HTTPS protocol.

    Meta - Lhjyjj.com

    Number of occurences: 3
    • Name:
      Content:
    • Name: keywords
      Content: 辽化教育奖励基金
    • Name: description
      Content:

    Server / Hosting

    • IP: 121.42.112.1
    • Latitude: 30.29
    • Longitude: 120.16
    • Country: China
    • City: Hangzhou

    Rname

    • dns10.hichina.com
    • dns9.hichina.com

    Target

    • hostmaster.hichina.com

    HTTP Header Response

    HTTP/1.1 200 OK Content-Type: text/html Last-Modified: Sun, 14 Aug 2016 03:42:27 GMT Accept-Ranges: bytes ETag: "117ad2e0ddf5d11:0" Server: Microsoft-IIS/7.5 X-Powered-By: ASP.NET Date: Mon, 26 Sep 2016 06:45:57 GMT Content-Length: 15001 X-Cache: MISS from s_bd43 Via: 1.1 s_bd43 (squid/3.5.20) Connection: keep-alive

    DNS

    host: lhjyjj.com
    1. class: IN
    2. ttl: 600
    3. type: A
    4. ip: 121.42.112.1
    host: lhjyjj.com
    1. class: IN
    2. ttl: 86400
    3. type: NS
    4. target: dns10.hichina.com
    host: lhjyjj.com
    1. class: IN
    2. ttl: 86400
    3. type: NS
    4. target: dns9.hichina.com
    host: lhjyjj.com
    1. class: IN
    2. ttl: 600
    3. type: SOA
    4. mname: dns9.hichina.com
    5. rname: hostmaster.hichina.com
    6. serial: 2015041610
    7. refresh: 3600
    8. retry: 1200
    9. expire: 3600
    10. minimum-ttl: 360

    Common Typos/Mistakes

    This list shows You some spelling mistakes at internet search for this domain.

    www.hjyjj.com, www.luhjyjj.com, www.uhjyjj.com, www.l8hjyjj.com, www.8hjyjj.com, www.l9hjyjj.com, www.9hjyjj.com, www.ljhjyjj.com, www.jhjyjj.com, www.l0hjyjj.com, www.0hjyjj.com, www.lmhjyjj.com, www.mhjyjj.com, www.lphjyjj.com, www.phjyjj.com, www.lohjyjj.com, www.ohjyjj.com, www.ljyjj.com, www.lhejyjj.com, www.lejyjj.com, www.lhdjyjj.com, www.ldjyjj.com, www.lhcjyjj.com, www.lcjyjj.com, www.lhujyjj.com, www.lujyjj.com, www.lhjjyjj.com, www.ljjyjj.com, www.lhjyjj.com, www.ljyjj.com, www.lhbjyjj.com, www.lbjyjj.com, www.lhgjyjj.com, www.lgjyjj.com, www.lhyjj.com, www.lhjzyjj.com, www.lhzyjj.com, www.lhjhyjj.com, www.lhhyjj.com, www.lhjnyjj.com, www.lhnyjj.com, www.lhj.yjj.com, www.lh.yjj.com, www.lhjuyjj.com, www.lhuyjj.com, www.lhjkyjj.com, www.lhkyjj.com, www.lhjlyjj.com, www.lhlyjj.com, www.lhjoyjj.com, www.lhoyjj.com, www.lhjjj.com, www.lhjyzjj.com, www.lhjzjj.com, www.lhjyajj.com, www.lhjajj.com, www.lhjysjj.com, www.lhjsjj.com, www.lhjydjj.com, www.lhjdjj.com, www.lhjyjj.com, www.lhjjj.com, www.lhjycjj.com, www.lhjcjj.com, www.lhjy jj.com, www.lhj jj.com, www.lhjyj.com, www.lhjyjzj.com, www.lhjyzj.com, www.lhjyjhj.com, www.lhjyhj.com, www.lhjyjnj.com, www.lhjynj.com, www.lhjyj.j.com, www.lhjy.j.com, www.lhjyjuj.com, www.lhjyuj.com, www.lhjyjkj.com, www.lhjykj.com, www.lhjyjlj.com, www.lhjylj.com, www.lhjyjoj.com, www.lhjyoj.com, www.lhjyj.com, www.lhjyjjz.com, www.lhjyjz.com, www.lhjyjjh.com, www.lhjyjh.com, www.lhjyjjn.com, www.lhjyjn.com, www.lhjyjj..com, www.lhjyj..com, www.lhjyjju.com, www.lhjyju.com, www.lhjyjjk.com, www.lhjyjk.com, www.lhjyjjl.com, www.lhjyjl.com, www.lhjyjjo.com, www.lhjyjo.com,

    Other websites we recently analyzed

    1. 首页-深圳市凯利盈科技有限公司
      首页
      Central District (Hong Kong) - 113.10.244.56
      Server software: Microsoft-IIS/6.0
      Technology: CSS, Html, Javascript, jQuery, Php
      Number of Javascript: 10
      Number of meta tags: 4
    2. supremelogisticsllc.com
      United States - 208.91.197.27
      Server software: Apache
      Technology: Html
      Number of meta tags: 2
    3. apztec Support
      Ashburn (United States) - 54.88.230.97
      Server software: nginx/1.11.3
      Technology: CSS, Html, Javascript, Php
      Number of Javascript: 3
      Number of meta tags: 1
    4. rosanne.
      San Francisco (United States) - 192.0.78.24
      Server software: nginx
      Technology: CSS, Google Font API, Gravatar, Html, Html5, Javascript, Php, Pingback, Shortcodes, SVG, comScore, Wordpress
      Number of Javascript: 6
      Number of meta tags: 9
    5. Fotos
      Dallas (United States) - 67.228.150.34
      Server software: Microsoft-IIS/7.5
      Technology: Html
      Number of meta tags: 1
    6. pennsylvaniamalpracticelawyers.info
      Scottsdale (United States) - 50.63.202.62
      Server software:
      Technology: Html, Html5, Iframe
    7. Pet Kraft
      United States - 208.91.199.87
      Server software: Apache Phusion_Passenger/4.0.10 mod_bwlimited/1.4 mod_fcgid/2.3.9
      Technology: CSS, Html, Javascript, jQuery, Php
      Number of Javascript: 8
      Number of meta tags: 1
    8. califoncoffee.com
      Scottsdale (United States) - 184.168.221.61
      Server software: Microsoft-IIS/7.5
      Technology: Html, Html5, Iframe
    9. donateordance.net
      Scottsdale (United States) - 184.168.221.63
      Server software: Microsoft-IIS/7.5
      Technology: Html, Html5, Iframe
    10. Home
      Studio City (United States) - 205.144.171.109
      Server software: Microsoft-IIS/8.5
      Technology: CSS, Html, Javascript
      Number of Javascript: 4
      Number of meta tags: 3

    Check Other Websites